(data stored in ACNUC7421 zone)

EMBL: AP010803.PURH

AP010803.PURH        Location/Qualifiers
FT   CDS             316422..318011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SJA_C1-03000"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="bifunctional purine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95134"
FT                   /db_xref="GOA:D4YXQ2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ2"
FT                   /protein_id="BAI95134.1"
FT                   /translation="MSDVTIKRALLSVSDKSGLIELGQALGRHGVELVSTGGTAKALRE
FT                   AGLAVKDISDLTGFPEMMDGRVKTLHPKVHGGLLAVRGNAEHVAAMQAHDIGAIDLVVV
FT                   NLYPFAATVAKGADREEIIENIDIGGPSMVRSAAKNHESVAIVTDPADYARLVAEMEEK
FT                   GGATSYDFRRMLAAKAYAATAAYDSMIASWFAFADQGAQFPESLSVSSRLGSTLRYGEN
FT                   PHQSAALYLPVGPSANGIAQARQVQGKELSYNNYNDADAALELVSEFRDGPPTVVIVKH
FT                   ANPCGVATGATLIEAYEAALACDSVSAFGGIIAVNRPLDGPTAEAISGIFTEVVAAPDA
FT                   DEDAKAIFAKKKNLRLLLTGDLPDPARPGLQIKSIAGGLLVQGRDNGRITRDQLKVVTK
FT                   RAPTEQELNDCLFAWTVAKHVKSNAIVYAKAGSTAGIGAGQMNRLESARIAAWKAKDAA
FT                   EKAGWAEARTLGSAVASDAFFPFADGLLAAVEAGATAVIQPGGSIRDEEVIAAADEAGL
FT                   AMVFTGMRHFRH"
     MSDVTIKRAL LSVSDKSGLI ELGQALGRHG VELVSTGGTA KALREAGLAV KDISDLTGFP        60
     EMMDGRVKTL HPKVHGGLLA VRGNAEHVAA MQAHDIGAID LVVVNLYPFA ATVAKGADRE       120
     EIIENIDIGG PSMVRSAAKN HESVAIVTDP ADYARLVAEM EEKGGATSYD FRRMLAAKAY       180
     AATAAYDSMI ASWFAFADQG AQFPESLSVS SRLGSTLRYG ENPHQSAALY LPVGPSANGI       240
     AQARQVQGKE LSYNNYNDAD AALELVSEFR DGPPTVVIVK HANPCGVATG ATLIEAYEAA       300
     LACDSVSAFG GIIAVNRPLD GPTAEAISGI FTEVVAAPDA DEDAKAIFAK KKNLRLLLTG       360
     DLPDPARPGL QIKSIAGGLL VQGRDNGRIT RDQLKVVTKR APTEQELNDC LFAWTVAKHV       420
     KSNAIVYAKA GSTAGIGAGQ MNRLESARIA AWKAKDAAEK AGWAEARTLG SAVASDAFFP       480
     FADGLLAAVE AGATAVIQPG GSIRDEEVIA AADEAGLAMV FTGMRHFRH                   529
//

If you have problems or comments...

PBIL Back to PBIL home page