(data stored in ACNUC7421 zone)

EMBL: AP010803.RIBD

AP010803.RIBD        Location/Qualifiers
FT   CDS             307882..308835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SJA_C1-02910"
FT                   /product="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="bifunctional protein"
FT                   /note="pyrimidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95125"
FT                   /db_xref="GOA:D4YXP3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP3"
FT                   /protein_id="BAI95125.1"
FT                   /translation="MAAAIALSQRGRGLSTPNPNVGCLIVKDGHVVGRGWTQRGGRPHA
FT                   EAQALDEALDRARGATAYVTLEPCFHLSPRGPRCADRMARAGVRRVVIALRDPDPRTDG
FT                   QGAAWLRQHGVAVDMGLMAGEAAAAMRGFVLRQTLGRPAVTLKLGLSLDGRIALADGSS
FT                   RWITGPEARAHAHMERARHDAILVGGGTLRADAPRLDVRLLGLEDRSPRRVLLSHGDAP
FT                   GGWETIAAPEDIAALPQVDHLLVEGGAQAAAAFLRADLVDRLLLYRAPILIGAGLAGVG
FT                   DIGLTDLAGAHGRWRLDDERRLGNDRLEVYLRSRNA"
     MAAAIALSQR GRGLSTPNPN VGCLIVKDGH VVGRGWTQRG GRPHAEAQAL DEALDRARGA        60
     TAYVTLEPCF HLSPRGPRCA DRMARAGVRR VVIALRDPDP RTDGQGAAWL RQHGVAVDMG       120
     LMAGEAAAAM RGFVLRQTLG RPAVTLKLGL SLDGRIALAD GSSRWITGPE ARAHAHMERA       180
     RHDAILVGGG TLRADAPRLD VRLLGLEDRS PRRVLLSHGD APGGWETIAA PEDIAALPQV       240
     DHLLVEGGAQ AAAAFLRADL VDRLLLYRAP ILIGAGLAGV GDIGLTDLAG AHGRWRLDDE       300
     RRLGNDRLEV YLRSRNA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page