(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLB

AP010803.RPLB        Location/Qualifiers
FT   CDS             645295..646131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SJA_C1-06300"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95464"
FT                   /db_xref="GOA:D4YYN2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN2"
FT                   /protein_id="BAI95464.1"
FT                   /translation="MALKSYNPTSPAQRGLILVDRSALHKGKPVKALTEGKRKTGGRNN
FT                   KGHVTSRGIAGGHKQRYRIIDFKRRLWDVEGTVERLEYDPNRTAFIALVNYPDGTQAYI
FT                   LAPQRLAPGDKVIAGKKTDVKPGNAMELGQMPVGTIIHNIEMKPGKGGQLCRSAGTYAQ
FT                   LVGRDRGMVMVRLSSGEQRYIRSDCMGTVGAVSNPDNANTNLAKAGRNRWLGKRPLTRG
FT                   VAKNPVDHPHGGGEGRTSGGRHPVTPWGKPTKGARTRHNKATDKFIIRSRHAKKKR"
     MALKSYNPTS PAQRGLILVD RSALHKGKPV KALTEGKRKT GGRNNKGHVT SRGIAGGHKQ        60
     RYRIIDFKRR LWDVEGTVER LEYDPNRTAF IALVNYPDGT QAYILAPQRL APGDKVIAGK       120
     KTDVKPGNAM ELGQMPVGTI IHNIEMKPGK GGQLCRSAGT YAQLVGRDRG MVMVRLSSGE       180
     QRYIRSDCMG TVGAVSNPDN ANTNLAKAGR NRWLGKRPLT RGVAKNPVDH PHGGGEGRTS       240
     GGRHPVTPWG KPTKGARTRH NKATDKFIIR SRHAKKKR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page