(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLF

AP010803.RPLF        Location/Qualifiers
FT   CDS             650614..651147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SJA_C1-06420"
FT                   /product="ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95476"
FT                   /db_xref="GOA:D4YYP4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP4"
FT                   /protein_id="BAI95476.1"
FT                   /translation="MSRTGKKPVAVPAGVTAAIADGQLSVKGPKGTLSLPLADEVTYSI
FT                   EEGSIAVKPANDSKRARAFWGMQRTLIANLITGVTEGFSKKLLITGVGYRANAQGKTLK
FT                   LQLGYSHDVDFAVPEGIEIKTPDNTTVEISGIDKQKVGQVAAEIRRWRKPEPYKGKGIK
FT                   YAGEFIFRKEGKKK"
     MSRTGKKPVA VPAGVTAAIA DGQLSVKGPK GTLSLPLADE VTYSIEEGSI AVKPANDSKR        60
     ARAFWGMQRT LIANLITGVT EGFSKKLLIT GVGYRANAQG KTLKLQLGYS HDVDFAVPEG       120
     IEIKTPDNTT VEISGIDKQK VGQVAAEIRR WRKPEPYKGK GIKYAGEFIF RKEGKKK          177
//

If you have problems or comments...

PBIL Back to PBIL home page