(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLM

AP010803.RPLM        Location/Qualifiers
FT   CDS             615899..616378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SJA_C1-06030"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95437"
FT                   /db_xref="GOA:D4YYK5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK5"
FT                   /protein_id="BAI95437.1"
FT                   /translation="MKALMKTTKPATPATVEKKWVLIDAEGLVVGRLASTVANILRGKH
FT                   KPSFTPHVDCGDNVIIINAEKVKFTGRKLTDKVYYKHTGYAGGIKETTPQKVLEGRFPE
FT                   RVLEKAVERMIPRGPLGRQQMRNLRIFAGAEHPHAAQNPEVLDFASRNRKNKVGA"
     MKALMKTTKP ATPATVEKKW VLIDAEGLVV GRLASTVANI LRGKHKPSFT PHVDCGDNVI        60
     IINAEKVKFT GRKLTDKVYY KHTGYAGGIK ETTPQKVLEG RFPERVLEKA VERMIPRGPL       120
     GRQQMRNLRI FAGAEHPHAA QNPEVLDFAS RNRKNKVGA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page