(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLN

AP010803.RPLN        Location/Qualifiers
FT   CDS             648599..648967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SJA_C1-06370"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95471"
FT                   /db_xref="GOA:D4YYN9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN9"
FT                   /protein_id="BAI95471.1"
FT                   /translation="MIQMQSNLDVADNSGAKRVQCIKVLGGSKRRFASVGDIIVVSIKE
FT                   AAPRGKVKKGDVHRAVIVRTAKDVRRADGSVIRFDGNAAVLINKNEEPIGTRIFGPVVR
FT                   ELRAKKHMKIISLAPEVL"
     MIQMQSNLDV ADNSGAKRVQ CIKVLGGSKR RFASVGDIIV VSIKEAAPRG KVKKGDVHRA        60
     VIVRTAKDVR RADGSVIRFD GNAAVLINKN EEPIGTRIFG PVVRELRAKK HMKIISLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page