(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLO

AP010803.RPLO        Location/Qualifiers
FT   CDS             652550..653086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SJA_C1-06460"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95480"
FT                   /db_xref="GOA:D4YYP8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP8"
FT                   /protein_id="BAI95480.1"
FT                   /translation="MTKLNELNDNAGARKGRMRVGRGIGSGKGKTAGRGQKGAKARSGV
FT                   SINGFEGGQMPLHMRLPKRGFNNIFAKDFAIVNLGAVQKAIDAGKLDANATIDHAALKA
FT                   AALARGGKDGVRLLAKGDLTAKVSFLVAGASKGAVEAVEKAGGKVDVIAVVPAAEKAKA
FT                   KKGTALAAKKAAAKA"
     MTKLNELNDN AGARKGRMRV GRGIGSGKGK TAGRGQKGAK ARSGVSINGF EGGQMPLHMR        60
     LPKRGFNNIF AKDFAIVNLG AVQKAIDAGK LDANATIDHA ALKAAALARG GKDGVRLLAK       120
     GDLTAKVSFL VAGASKGAVE AVEKAGGKVD VIAVVPAAEK AKAKKGTALA AKKAAAKA         178
//

If you have problems or comments...

PBIL Back to PBIL home page