(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLP

AP010803.RPLP        Location/Qualifiers
FT   CDS             647520..647951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SJA_C1-06340"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95468"
FT                   /db_xref="GOA:D4YYN6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN6"
FT                   /protein_id="BAI95468.1"
FT                   /translation="MLQPKKMKFRKTFKGRIKGDAKGGSALNFGAYGLKALEPERVTAR
FT                   QIEAARRAIQRHLRRQGRLWIRVFPDVPVSKKPAEVRQGKGKGSVEYWAARVKPGRILF
FT                   ELDGVPGPLAAEAFSRAAMKLPIKTKVVARLGDTSHLEG"
     MLQPKKMKFR KTFKGRIKGD AKGGSALNFG AYGLKALEPE RVTARQIEAA RRAIQRHLRR        60
     QGRLWIRVFP DVPVSKKPAE VRQGKGKGSV EYWAARVKPG RILFELDGVP GPLAAEAFSR       120
     AAMKLPIKTK VVARLGDTSH LEG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page