(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLQ

AP010803.RPLQ        Location/Qualifiers
FT   CDS             complement(589695..590120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SJA_C1-05780"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95412"
FT                   /db_xref="GOA:D4YYI0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI0"
FT                   /protein_id="BAI95412.1"
FT                   /translation="MRHKVGHRKLQRSAGHRNSLLRNLAASLIKHEQILTTTPKAKELR
FT                   PYVEKLITLAKKGGLSNRRLAHARLQDDAQLTKLFDVLAERYKDRNGGYTRVIKAGIRA
FT                   SDAAPIAIIELVDRDVDAKGQDSGPVQNADADELEAA"
     MRHKVGHRKL QRSAGHRNSL LRNLAASLIK HEQILTTTPK AKELRPYVEK LITLAKKGGL        60
     SNRRLAHARL QDDAQLTKLF DVLAERYKDR NGGYTRVIKA GIRASDAAPI AIIELVDRDV       120
     DAKGQDSGPV QNADADELEA A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page