(data stored in ACNUC7421 zone)

EMBL: AP010803.RPLV

AP010803.RPLV        Location/Qualifiers
FT   CDS             646415..646798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SJA_C1-06320"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95466"
FT                   /db_xref="GOA:D4YYN4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN4"
FT                   /protein_id="BAI95466.1"
FT                   /translation="MSKEKAPRRVADNEALAVGTQIRGSAQKLNLVATLIRGRKVEDAL
FT                   NILAFSKKAMAVDVRKVLASAIANAENNHNLDVDSLVVAEASVGKSFTMKRFHARGRGK
FT                   STRILKPFSRVRIVVREQAEAEA"
     MSKEKAPRRV ADNEALAVGT QIRGSAQKLN LVATLIRGRK VEDALNILAF SKKAMAVDVR        60
     KVLASAIANA ENNHNLDVDS LVVAEASVGK SFTMKRFHAR GRGKSTRILK PFSRVRIVVR       120
     EQAEAEA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page