(data stored in SCRATCH zone)

EMBL: AP010803.RPLX

AP010803.RPLX        Location/Qualifiers
FT   CDS             648967..649278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SJA_C1-06380"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95472"
FT                   /db_xref="GOA:D4YYP0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP0"
FT                   /protein_id="BAI95472.1"
FT                   /translation="MSAAKIKKGDKVVILAGKDKGRTGAVLQVLPKDDKVLVEGINVHA
FT                   RHRKPDQANPQGGIERKPAPLHISNVAVADKDGKPTRVRFEDRDGKKVRVAVKSGEVL"
     MSAAKIKKGD KVVILAGKDK GRTGAVLQVL PKDDKVLVEG INVHARHRKP DQANPQGGIE        60
     RKPAPLHISN VAVADKDGKP TRVRFEDRDG KKVRVAVKSG EVL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page