(data stored in ACNUC7421 zone)

EMBL: AP010803.RPMC

AP010803.RPMC        Location/Qualifiers
FT   CDS             647955..648158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SJA_C1-06350"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95469"
FT                   /db_xref="GOA:D4YYN7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN7"
FT                   /protein_id="BAI95469.1"
FT                   /translation="MANVADLKTKTDDELSTELNNLKREQFNLRFQAATNQLEKPSRVR
FT                   EVRRSIAQIKTLQSERSRSVAK"
     MANVADLKTK TDDELSTELN NLKREQFNLR FQAATNQLEK PSRVREVRRS IAQIKTLQSE        60
     RSRSVAK                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page