(data stored in ACNUC7421 zone)

EMBL: AP010803.RPOA

AP010803.RPOA        Location/Qualifiers
FT   CDS             complement(590298..591362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SJA_C1-05790"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95413"
FT                   /db_xref="GOA:D4YYI1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI1"
FT                   /protein_id="BAI95413.1"
FT                   /translation="MTVNMKNWQELKKPNSLEIKVAGDGRRKATFVAEPLERGFGLTLG
FT                   NALRRVLLSSLQGAAVTSIKIENVLHEFSSLAGVREDVTDIVLNIKQVALRMEGDGPRR
FT                   LQLSATGPAEVRAGDITTVGDIEVMNPDLVICHLDQGATLNMELTADVGKGYVPAVANR
FT                   PADAPIGLIPIDALYSPVRQVAYKVDNTRVGQELDYDKLSLTVETDGTVTPEDAVAYAA
FT                   RILQDQLQLFVHFEDALPAAAPAAGAAAGGSASEGESDANQINRYLLKKVDELELSVRS
FT                   ANCLKNDNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLSSMGLRLGMDIPGWPPEN
FT                   IEEMAKKLEQELLG"
     MTVNMKNWQE LKKPNSLEIK VAGDGRRKAT FVAEPLERGF GLTLGNALRR VLLSSLQGAA        60
     VTSIKIENVL HEFSSLAGVR EDVTDIVLNI KQVALRMEGD GPRRLQLSAT GPAEVRAGDI       120
     TTVGDIEVMN PDLVICHLDQ GATLNMELTA DVGKGYVPAV ANRPADAPIG LIPIDALYSP       180
     VRQVAYKVDN TRVGQELDYD KLSLTVETDG TVTPEDAVAY AARILQDQLQ LFVHFEDALP       240
     AAAPAAGAAA GGSASEGESD ANQINRYLLK KVDELELSVR SANCLKNDNI IYIGDLVQKT       300
     EAEMLRTPNF GRKSLNEIKE VLSSMGLRLG MDIPGWPPEN IEEMAKKLEQ ELLG             354
//

If you have problems or comments...

PBIL Back to PBIL home page