(data stored in ACNUC7421 zone)

EMBL: AP010803.RPON

AP010803.RPON        Location/Qualifiers
FT   CDS             3824..4420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SJA_C1-00060"
FT                   /product="sigma 54"
FT                   /note="ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94840"
FT                   /db_xref="GOA:D4YWV8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV8"
FT                   /protein_id="BAI94840.1"
FT                   /translation="MDIRVSGHQVDTGDALKQHVWTRLEAMAEKYFSRALSAQVTFRPA
FT                   PHGAFHCDIVCHVMTGLILKGAGEAQEAHPAFDQAAERIEKQLRRYLRRLKDRSAQAAA
FT                   AEANRANGFSVEELDGAGYTIFASPADEEEPAEAPLIVAETKVDIPEASVSDAVMMLDL
FT                   RNTNALLFVNAGTAAYNMVYRRQDGTIGWVEPRLA"
     MDIRVSGHQV DTGDALKQHV WTRLEAMAEK YFSRALSAQV TFRPAPHGAF HCDIVCHVMT        60
     GLILKGAGEA QEAHPAFDQA AERIEKQLRR YLRRLKDRSA QAAAAEANRA NGFSVEELDG       120
     AGYTIFASPA DEEEPAEAPL IVAETKVDIP EASVSDAVMM LDLRNTNALL FVNAGTAAYN       180
     MVYRRQDGTI GWVEPRLA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page