(data stored in SCRATCH zone)

EMBL: AP010803.RPSC

AP010803.RPSC        Location/Qualifiers
FT   CDS             646803..647498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SJA_C1-06330"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95467"
FT                   /db_xref="GOA:D4YYN5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN5"
FT                   /protein_id="BAI95467.1"
FT                   /translation="MGHKSNPIGLRLQINRTWDSRWFAEGADYGRLLLEDLKIRQFIMK
FT                   NLPQAAISKVVIERPAKLCRVSIYAARPGVIIGKKGADIEKLRKKLGGLTSSDVSLNIV
FT                   EIRKPEIDSKLVAQGIADQLERRVAFRRAMKRAVQSALRLGAEGIKITCGGRLGGAEIA
FT                   RVEWYREGRVPLHTLRANVDYAEAEAHTAYGVCGIKVWIFKGEILGHDPMATDRLMLEA
FT                   QTSGVRPAR"
     MGHKSNPIGL RLQINRTWDS RWFAEGADYG RLLLEDLKIR QFIMKNLPQA AISKVVIERP        60
     AKLCRVSIYA ARPGVIIGKK GADIEKLRKK LGGLTSSDVS LNIVEIRKPE IDSKLVAQGI       120
     ADQLERRVAF RRAMKRAVQS ALRLGAEGIK ITCGGRLGGA EIARVEWYRE GRVPLHTLRA       180
     NVDYAEAEAH TAYGVCGIKV WIFKGEILGH DPMATDRLML EAQTSGVRPA R                231
//

If you have problems or comments...

PBIL Back to PBIL home page