(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSE

AP010803.RPSE        Location/Qualifiers
FT   CDS             651506..652213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SJA_C1-06440"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95478"
FT                   /db_xref="GOA:D4YYP6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP6"
FT                   /protein_id="BAI95478.1"
FT                   /translation="MADENEIQAQPGAPAAVEGGEQTEGRRGRGRGGDRNRGERGGRGR
FT                   RDDRRGNRDEEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAR
FT                   EVPEAISKATASAKKAMVRVPLKEGRTLHHDGLGHFGAGKVTVRSAPAGTGIIAGGPMR
FT                   AVFESLGVADVVTKSNGTSNPYNMIRATFAALGEQTSPKSVAQRRGKKVADLLRRGGAS
FT                   AEVAQADAEAIAE"
     MADENEIQAQ PGAPAAVEGG EQTEGRRGRG RGGDRNRGER GGRGRRDDRR GNRDEEQGEE        60
     LIEKLVHINR VSKTVKGGKR FGFAALVVVG DGKGRAGFGH GKAREVPEAI SKATASAKKA       120
     MVRVPLKEGR TLHHDGLGHF GAGKVTVRSA PAGTGIIAGG PMRAVFESLG VADVVTKSNG       180
     TSNPYNMIRA TFAALGEQTS PKSVAQRRGK KVADLLRRGG ASAEVAQADA EAIAE            235
//

If you have problems or comments...

PBIL Back to PBIL home page