(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSG

AP010803.RPSG        Location/Qualifiers
FT   CDS             638721..639191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SJA_C1-06230"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95457"
FT                   /db_xref="GOA:D4YYM5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM5"
FT                   /protein_id="BAI95457.1"
FT                   /translation="MSRRRRPEKRVILPDPKFGDVVLSKFMNSIMQDGKKAVAESIVYG
FT                   ALDTVEAKSKKDPIAMFHDALNNVKPGIEVRSRRVGGATYQVPVEVRPERAQALAIRWL
FT                   ITASRNRSETTMAARLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW"
     MSRRRRPEKR VILPDPKFGD VVLSKFMNSI MQDGKKAVAE SIVYGALDTV EAKSKKDPIA        60
     MFHDALNNVK PGIEVRSRRV GGATYQVPVE VRPERAQALA IRWLITASRN RSETTMAARL       120
     SGELLDAANN RGNAVKKRED THRMAEANRA FSHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page