(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSH

AP010803.RPSH        Location/Qualifiers
FT   CDS             650219..650614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SJA_C1-06410"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95475"
FT                   /db_xref="GOA:D4YYP3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP3"
FT                   /protein_id="BAI95475.1"
FT                   /translation="MALTDPLGDMLTRIRNGQQAKKDSVVSPASKLRARVLDVLQREGY
FT                   IRGYSEELLGNHPGLRIELKYFEGQPAIKHVARVSKPGRRVYSGSKELPVIRNGLGITI
FT                   VSTPRGVLSDAEAREQNVGGEVLAEVF"
     MALTDPLGDM LTRIRNGQQA KKDSVVSPAS KLRARVLDVL QREGYIRGYS EELLGNHPGL        60
     RIELKYFEGQ PAIKHVARVS KPGRRVYSGS KELPVIRNGL GITIVSTPRG VLSDAEAREQ       120
     NVGGEVLAEV F                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page