(data stored in SCRATCH zone)

EMBL: AP010803.RPSI

AP010803.RPSI        Location/Qualifiers
FT   CDS             616378..616905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SJA_C1-06040"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95438"
FT                   /db_xref="GOA:D4YYK6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK6"
FT                   /protein_id="BAI95438.1"
FT                   /translation="MSDNRQSLSDLASLTANAPAPAAAPAADAPIAPAQPAAPLRAQEI
FT                   DSLGRAYATGRRKDAVARVWVKPGTGKITVNGRDQEIYFARPTLRLVINQPFGVTEREG
FT                   QYDVIATVKGGGLSGQAGAVKHGIAQALAKYEPALRSAVKAEGFLTRDSRAVERKKYGK
FT                   AKARRSFQFSKR"
     MSDNRQSLSD LASLTANAPA PAAAPAADAP IAPAQPAAPL RAQEIDSLGR AYATGRRKDA        60
     VARVWVKPGT GKITVNGRDQ EIYFARPTLR LVINQPFGVT EREGQYDVIA TVKGGGLSGQ       120
     AGAVKHGIAQ ALAKYEPALR SAVKAEGFLT RDSRAVERKK YGKAKARRSF QFSKR            175
//

If you have problems or comments...

PBIL Back to PBIL home page