(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSJ

AP010803.RPSJ        Location/Qualifiers
FT   CDS             642975..643283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SJA_C1-06260"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95460"
FT                   /db_xref="GOA:D4YYM8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM8"
FT                   /protein_id="BAI95460.1"
FT                   /translation="MDSNIRIRLKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRI
FT                   EKFTVNRGPHIDKKSREQFEVRTYKRMLDIVQPTPQTVDALMKLDLAAGVNVEIKLA"
     MDSNIRIRLK AFDHRVLDQA TGDIADTARR TGALIRGPIP LPTRIEKFTV NRGPHIDKKS        60
     REQFEVRTYK RMLDIVQPTP QTVDALMKLD LAAGVNVEIK LA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page