(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSK

AP010803.RPSK        Location/Qualifiers
FT   CDS             complement(591484..591873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SJA_C1-05800"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95414"
FT                   /db_xref="GOA:D4YYI2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI2"
FT                   /protein_id="BAI95414.1"
FT                   /translation="MAREPQRIKRRERKNISAGVAHVNASFNNTMVTITDAQGNAISWS
FT                   SAGMMGFKGSRKSTPYAAQVCAEDAGRKAAEHGVRTLEVEVKGPGSGRESALRALQAVG
FT                   FHITSIRDVTPIPHNGVRPSKRRRV"
     MAREPQRIKR RERKNISAGV AHVNASFNNT MVTITDAQGN AISWSSAGMM GFKGSRKSTP        60
     YAAQVCAEDA GRKAAEHGVR TLEVEVKGPG SGRESALRAL QAVGFHITSI RDVTPIPHNG       120
     VRPSKRRRV                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page