(data stored in SCRATCH zone)

EMBL: AP010803.RPSL

AP010803.RPSL        Location/Qualifiers
FT   CDS             638334..638705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SJA_C1-06220"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95456"
FT                   /db_xref="GOA:D4YYM4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM4"
FT                   /protein_id="BAI95456.1"
FT                   /translation="MPTINQLVRKGRELQKTKSKVPAMEANPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLVNQREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDT
FT                   QGVKDRKQSRSKYGAKRPK"
     MPTINQLVRK GRELQKTKSK VPAMEANPQK RGVCTRVYTT TPKKPNSALR KVAKVRLVNQ        60
     REVITYIPGE GHNLQEHSVV LIRGGRVRDL PGVRYHVLRG VLDTQGVKDR KQSRSKYGAK       120
     RPK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page