(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSM

AP010803.RPSM        Location/Qualifiers
FT   CDS             complement(591975..592343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SJA_C1-05810"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95415"
FT                   /db_xref="GOA:D4YYI3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI3"
FT                   /protein_id="BAI95415.1"
FT                   /translation="MARIAGVNIPTNKRVIIALTYIHGIGRKTAVDIADKLGIDHSRRV
FT                   QDLSDAEVLQIRETIDADLTVEGDLRRETAMNIKRLMDLACYRGLRHRKGLPVRGQRTH
FT                   TNARTRKGKAKPIAGKKK"
     MARIAGVNIP TNKRVIIALT YIHGIGRKTA VDIADKLGID HSRRVQDLSD AEVLQIRETI        60
     DADLTVEGDL RRETAMNIKR LMDLACYRGL RHRKGLPVRG QRTHTNARTR KGKAKPIAGK       120
     KK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page