(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSN

AP010803.RPSN        Location/Qualifiers
FT   CDS             649901..650206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SJA_C1-06400"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95474"
FT                   /db_xref="GOA:D4YYP2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP2"
FT                   /protein_id="BAI95474.1"
FT                   /translation="MAKLSSINKNERRKKLVKKYAGRYAKLKAIANDTTADDSDRLIAR
FT                   LKMAEIPRNGNPTRVRNRCELTGRPRAYYRKFRLCRVQLRDLANKGLIPGVTKSSW"
     MAKLSSINKN ERRKKLVKKY AGRYAKLKAI ANDTTADDSD RLIARLKMAE IPRNGNPTRV        60
     RNRCELTGRP RAYYRKFRLC RVQLRDLANK GLIPGVTKSS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page