(data stored in ACNUC7421 zone)

EMBL: AP010803.RPSS

AP010803.RPSS        Location/Qualifiers
FT   CDS             646137..646415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SJA_C1-06310"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95465"
FT                   /db_xref="GOA:D4YYN3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYN3"
FT                   /protein_id="BAI95465.1"
FT                   /translation="MARSVWKGPFVDLSLLKKAEVAQDAGGRSGPIKTWSRRSTILPQF
FT                   VGLTFNVYNGRKHVPVSVNEDMVGHKLGEFAPTRYFPGHAADKKGKR"
     MARSVWKGPF VDLSLLKKAE VAQDAGGRSG PIKTWSRRST ILPQFVGLTF NVYNGRKHVP        60
     VSVNEDMVGH KLGEFAPTRY FPGHAADKKG KR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page