(data stored in SCRATCH zone)

EMBL: AP010803.RUVA

AP010803.RUVA        Location/Qualifiers
FT   CDS             101048..101656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SJA_C1-00990"
FT                   /product="Holliday junction resolvasome DNA-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94933"
FT                   /db_xref="GOA:D4YX51"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX51"
FT                   /protein_id="BAI94933.1"
FT                   /translation="MIAKLKGRLDSTGLDHAIIDVGGVGYLVGASSRTLAALGPVGEAV
FT                   TVHTEMLVSDDAIRLVGFARAEERDWFRLLTGVQGVGSRVALAILSALEPVELHRAVAA
FT                   GDKAMIARANGVGPKLAQRIANELKDKIGAAPMPAGAVGAGFAALPTGGHSADAISALQ
FT                   NLGFKPAEASIAVAAAEEELGEDASLDALVRLALRKAAK"
     MIAKLKGRLD STGLDHAIID VGGVGYLVGA SSRTLAALGP VGEAVTVHTE MLVSDDAIRL        60
     VGFARAEERD WFRLLTGVQG VGSRVALAIL SALEPVELHR AVAAGDKAMI ARANGVGPKL       120
     AQRIANELKD KIGAAPMPAG AVGAGFAALP TGGHSADAIS ALQNLGFKPA EASIAVAAAE       180
     EELGEDASLD ALVRLALRKA AK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page