(data stored in ACNUC7421 zone)

EMBL: AP010803.RUVC

AP010803.RUVC        Location/Qualifiers
FT   CDS             101735..102061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="SJA_C1-01000"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /note="putative endonuclease containing a URI domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94934"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX52"
FT                   /protein_id="BAI94934.1"
FT                   /translation="MKEPCVYILASQPYGTIYIGVTSNLLGRLHQHRTNGVPGFTGRYA
FT                   VHNLVRFEMCDTMEQAIRREKQLKRWHRQWKINLIETENPRWVDLAVGLGLPSLDQHQR
FT                   HDGC"
     MKEPCVYILA SQPYGTIYIG VTSNLLGRLH QHRTNGVPGF TGRYAVHNLV RFEMCDTMEQ        60
     AIRREKQLKR WHRQWKINLI ETENPRWVDL AVGLGLPSLD QHQRHDGC                    108
//

If you have problems or comments...

PBIL Back to PBIL home page