(data stored in ACNUC7421 zone)

EMBL: AP010803.SCO1

AP010803.SCO1        Location/Qualifiers
FT   CDS             complement(55261..55917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco1"
FT                   /locus_tag="SJA_C1-00560"
FT                   /product="uncharacterized protein Sco1"
FT                   /note="uncharacterized protein SCO1/SenC/PrrC, involved in
FT                   biogenesis of respiratory and photosynthetic systems"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94890"
FT                   /db_xref="GOA:D4YX08"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX08"
FT                   /protein_id="BAI94890.1"
FT                   /translation="MAGGAMNKALISLTLPFAALLAACNMGAGGNASSGDDSAQGDLHG
FT                   ASIGAPFTLTDQDGKKVRWDDFKGRYRLVYFGYTYCPDVCPVDLQRILQGFAKFEKAKP
FT                   ALAARVQPIFISVDPDRDTPAVLKTYVAAFHPRLIGLTGTPDEIAKVAKDFVVLYNKEE
FT                   AKGASGYLVSHSRTPYLFGGDGEPVALVPVDDPGTPDADEGDPAKVTAFLEKWVK"
     MAGGAMNKAL ISLTLPFAAL LAACNMGAGG NASSGDDSAQ GDLHGASIGA PFTLTDQDGK        60
     KVRWDDFKGR YRLVYFGYTY CPDVCPVDLQ RILQGFAKFE KAKPALAARV QPIFISVDPD       120
     RDTPAVLKTY VAAFHPRLIG LTGTPDEIAK VAKDFVVLYN KEEAKGASGY LVSHSRTPYL       180
     FGGDGEPVAL VPVDDPGTPD ADEGDPAKVT AFLEKWVK                               218
//

If you have problems or comments...

PBIL Back to PBIL home page