(data stored in ACNUC7421 zone)

EMBL: AP010803.SECD

AP010803.SECD        Location/Qualifiers
FT   CDS             597926..599527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SJA_C1-05880"
FT                   /product="preprotein translocase SecD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95422"
FT                   /db_xref="GOA:D4YYJ0"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ0"
FT                   /protein_id="BAI95422.1"
FT                   /translation="MLNFPRWAVVAILLPLLIGIACAVPSFLPDSVVGQLPKFMQTRVN
FT                   LGLDLSGGSHLLLEASTQDVAKQRIANMEEQVRTELRRGDTKIAIGDISSRDGKLSFMV
FT                   RNPSQVDAAVERIRPLTQGAGLTGQRDFNVEVVNSSTIVITPTKAGIDNAVKGAMEVAT
FT                   EVIRKRIDEMGTREPTIQQQGDNRIVVQVPGLQDPKALKDLLGQTAKLEFKLVDVNANP
FT                   AEVAQGRAPVGSEVLPYPTNPAGPPVIAVYRQVMVSGEDLTDAQQGYDQTGNQPIVNIR
FT                   FNGAGGRKFGQVTSQNVNRPFAIILDGQVLSAPNINEPILGGSAQISGSFTVESANQLA
FT                   IALRSGKLPVALTVVEERTVGPQLGADSIRAGLMASVIAVAAVAAFMFVSYGRFGMYAN
FT                   LAVAINVLVILGVMGILGATLTLPGIAGFVLTIGTAVDANVLIYERIREERRRGRGVVQ
FT                   AIEHGYKEASRTIFEANVTHAIAGGIMLALGSGPVKGFAIVLLIGIATSVFTAVTFTRL
FT                   LVSRWVRAKRPTEIHI"
     MLNFPRWAVV AILLPLLIGI ACAVPSFLPD SVVGQLPKFM QTRVNLGLDL SGGSHLLLEA        60
     STQDVAKQRI ANMEEQVRTE LRRGDTKIAI GDISSRDGKL SFMVRNPSQV DAAVERIRPL       120
     TQGAGLTGQR DFNVEVVNSS TIVITPTKAG IDNAVKGAME VATEVIRKRI DEMGTREPTI       180
     QQQGDNRIVV QVPGLQDPKA LKDLLGQTAK LEFKLVDVNA NPAEVAQGRA PVGSEVLPYP       240
     TNPAGPPVIA VYRQVMVSGE DLTDAQQGYD QTGNQPIVNI RFNGAGGRKF GQVTSQNVNR       300
     PFAIILDGQV LSAPNINEPI LGGSAQISGS FTVESANQLA IALRSGKLPV ALTVVEERTV       360
     GPQLGADSIR AGLMASVIAV AAVAAFMFVS YGRFGMYANL AVAINVLVIL GVMGILGATL       420
     TLPGIAGFVL TIGTAVDANV LIYERIREER RRGRGVVQAI EHGYKEASRT IFEANVTHAI       480
     AGGIMLALGS GPVKGFAIVL LIGIATSVFT AVTFTRLLVS RWVRAKRPTE IHI              533
//

If you have problems or comments...

PBIL Back to PBIL home page