(data stored in ACNUC7421 zone)

EMBL: AP010803.SECF

AP010803.SECF        Location/Qualifiers
FT   CDS             599543..600529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SJA_C1-05890"
FT                   /product="preprotein translocase SecF subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95423"
FT                   /db_xref="GOA:D4YYJ1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ1"
FT                   /protein_id="BAI95423.1"
FT                   /translation="MKLLKLVPDNTNIGFVKLRHWAFALTALLTVLAVGATFYKGLNLG
FT                   VDFVGGLMIEAKFETPPQTDRVRSVIDRLGVGDGSLQQFGDPKTVQIRLPLPEQGGAGA
FT                   ANAIVEKARKAMTAEFPGVTFSRYDTVSGKVSGELIQNGVLAVMLAVIGIAIFSWFRYE
FT                   WQFGVSTFVAIMHDVLMTLGFFAVTQLEFDLNIVAAVLTIVGYSINDKMVIDDRIRENM
FT                   RKYRKMDMKSLIDLSVNETLPRTVMTSVTVLLALGALLLLGGHVLRGFTAAMMLGIIVG
FT                   TYSSVYVSSSLLISLGLSPATAEKKASKANIAAQAERMGPRDDGARP"
     MKLLKLVPDN TNIGFVKLRH WAFALTALLT VLAVGATFYK GLNLGVDFVG GLMIEAKFET        60
     PPQTDRVRSV IDRLGVGDGS LQQFGDPKTV QIRLPLPEQG GAGAANAIVE KARKAMTAEF       120
     PGVTFSRYDT VSGKVSGELI QNGVLAVMLA VIGIAIFSWF RYEWQFGVST FVAIMHDVLM       180
     TLGFFAVTQL EFDLNIVAAV LTIVGYSIND KMVIDDRIRE NMRKYRKMDM KSLIDLSVNE       240
     TLPRTVMTSV TVLLALGALL LLGGHVLRGF TAAMMLGIIV GTYSSVYVSS SLLISLGLSP       300
     ATAEKKASKA NIAAQAERMG PRDDGARP                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page