(data stored in ACNUC7421 zone)

EMBL: AP010803.SECY

AP010803.SECY        Location/Qualifiers
FT   CDS             653277..654641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SJA_C1-06470"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95481"
FT                   /db_xref="GOA:D4YYP9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYP9"
FT                   /protein_id="BAI95481.1"
FT                   /translation="MASRADQLASNLSLAKFSQATDLKKRLWFTLGALIVFRFLSFVPL
FT                   PGVDPTALSQLYAQTNGGILDIFNTFSGGSLSRMSLIALGVMPYITASIVVQLAASLSP
FT                   QLAAIKKEGESGRKKLNQYTRYGTVGLTAVQGYFIAVGLESFGAQSGVQAVVDPGYLFR
FT                   VAAVVSLIGGTMFLMWLGEQITSRGIGNGVSLIIMAGIVAQLPVTLSNLFKSSSTGAIS
FT                   GLVIFLVIVLGFGLIAFICFMERAQRRVLIQYPKRQTRQGLMQADRSHLPLKVNTAGVI
FT                   PPIFASSLLLMPLTVSQFAGQTVAGESRLGDFVLTLNQYLSHGSPVYMALYGLGIVFFC
FT                   FFYTAVVFNPEETADNLKRNGGFIPGIRPGKNTENYLDYVLTRITVIGAAYLAFICLVP
FT                   EFAIARAGIPFYLGGTSLLIVVNVTVDTVTQIQSHLLAHQYGDLIKKAKLKGRLR"
     MASRADQLAS NLSLAKFSQA TDLKKRLWFT LGALIVFRFL SFVPLPGVDP TALSQLYAQT        60
     NGGILDIFNT FSGGSLSRMS LIALGVMPYI TASIVVQLAA SLSPQLAAIK KEGESGRKKL       120
     NQYTRYGTVG LTAVQGYFIA VGLESFGAQS GVQAVVDPGY LFRVAAVVSL IGGTMFLMWL       180
     GEQITSRGIG NGVSLIIMAG IVAQLPVTLS NLFKSSSTGA ISGLVIFLVI VLGFGLIAFI       240
     CFMERAQRRV LIQYPKRQTR QGLMQADRSH LPLKVNTAGV IPPIFASSLL LMPLTVSQFA       300
     GQTVAGESRL GDFVLTLNQY LSHGSPVYMA LYGLGIVFFC FFYTAVVFNP EETADNLKRN       360
     GGFIPGIRPG KNTENYLDYV LTRITVIGAA YLAFICLVPE FAIARAGIPF YLGGTSLLIV       420
     VNVTVDTVTQ IQSHLLAHQY GDLIKKAKLK GRLR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page