(data stored in ACNUC7421 zone)

EMBL: AP010803.SMC

AP010803.SMC         Location/Qualifiers
FT   CDS             89845..93288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SJA_C1-00910"
FT                   /product="chromosome segregation protein"
FT                   /note="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94925"
FT                   /db_xref="GOA:D4YX43"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX43"
FT                   /protein_id="BAI94925.1"
FT                   /translation="MQIKRLKLSGFKSFVDPTELRIEPGLTGIVGPNGCGKSNLLEAIR
FT                   WVMGESSAKSMRGGGMEDVIFAGTSTRPQRDFAEVSLLTVQEQGELFNAVEVAADGELE
FT                   VTRRIERGAGSAYRANGRDVRAKDVSLIFADAATGPHSPALVSQGRIAAVIAARPQERR
FT                   AMLEEAAGISGLHVRRKDAEQKLRAAEANLMRLDEILSDMDARANSLRRQAKAAERYIR
FT                   LSEQIRIAEARVIFARWREAAASADAARAEAKQAESAVAAAQEAQQAAAVHANAAVETL
FT                   ARKRAAAQAARDAASEAGHKLAALRTERDGAVRRLHDLAQQAARLEEDREREGTLANDA
FT                   AEAIARLTDEIAALKARIAQTESMRPDFAGRIARAEDAARDAELDLARAMAKQAGEQAE
FT                   LRVAEAALAAARSRLDRASREAQRLEAEAAALPDATPLEGKRAEALAAQQQAGADRDAA
FT                   EAAIRSAETSRAEAAEARAVAEAALSSARATLAALDSEAAALRRAVDSGTGNRSRALDR
FT                   LKAAPGYERALAAALGDDLEAPIAAEGKRRWTGAAALASDPPLPEGCTALSAHVSAPPE
FT                   LARRLAQVAVADGDEGQALAVGQRLVTRDGQLRRWDGYVAIEGGAAAAERLIRLNRLEA
FT                   IAAARPAAEAEVETARAAQDAASGREREAGQTLAAGRARLADADQRLRTALRAADEAAT
FT                   ALERLSGRREAIEERLSEARADLHAAQAEHDKAQAGRAAMPDGEETRAQVAALQQGSEK
FT                   ARLAVSQLQADQALADRALASDRERVAAADAEARGWRARAGEAAKRIAAMVERGEAIAK
FT                   ERAEIADQPDSLAAAIAALSEQGDTLTQAADTARREESEAEAALRTAEQRAAQAGEALA
FT                   TAREARATAAARAEAADEKRVETNRLSGERFECPPPVLPEKLGFASADIRIAQSEQAEH
FT                   DRLVTERERIGPVNLVAAQELEELEATQANSRAESEELSQAINRLRGSIGSLNREGRQR
FT                   LLAAFEAVDGHFRRLFTTLFNGGQAHLELIDSDDPLEAGLEIMAQPPGKKLAALTLLSG
FT                   GEQALTAVALIFGLFLTNPAPICVLDEVDAPLDDANVERFCDLLDAMVAQTDTRYLIVS
FT                   HNAVTMARMHRLFGVTMVERGVSRLVSVNLGGAEALLAAE"
     MQIKRLKLSG FKSFVDPTEL RIEPGLTGIV GPNGCGKSNL LEAIRWVMGE SSAKSMRGGG        60
     MEDVIFAGTS TRPQRDFAEV SLLTVQEQGE LFNAVEVAAD GELEVTRRIE RGAGSAYRAN       120
     GRDVRAKDVS LIFADAATGP HSPALVSQGR IAAVIAARPQ ERRAMLEEAA GISGLHVRRK       180
     DAEQKLRAAE ANLMRLDEIL SDMDARANSL RRQAKAAERY IRLSEQIRIA EARVIFARWR       240
     EAAASADAAR AEAKQAESAV AAAQEAQQAA AVHANAAVET LARKRAAAQA ARDAASEAGH       300
     KLAALRTERD GAVRRLHDLA QQAARLEEDR EREGTLANDA AEAIARLTDE IAALKARIAQ       360
     TESMRPDFAG RIARAEDAAR DAELDLARAM AKQAGEQAEL RVAEAALAAA RSRLDRASRE       420
     AQRLEAEAAA LPDATPLEGK RAEALAAQQQ AGADRDAAEA AIRSAETSRA EAAEARAVAE       480
     AALSSARATL AALDSEAAAL RRAVDSGTGN RSRALDRLKA APGYERALAA ALGDDLEAPI       540
     AAEGKRRWTG AAALASDPPL PEGCTALSAH VSAPPELARR LAQVAVADGD EGQALAVGQR       600
     LVTRDGQLRR WDGYVAIEGG AAAAERLIRL NRLEAIAAAR PAAEAEVETA RAAQDAASGR       660
     EREAGQTLAA GRARLADADQ RLRTALRAAD EAATALERLS GRREAIEERL SEARADLHAA       720
     QAEHDKAQAG RAAMPDGEET RAQVAALQQG SEKARLAVSQ LQADQALADR ALASDRERVA       780
     AADAEARGWR ARAGEAAKRI AAMVERGEAI AKERAEIADQ PDSLAAAIAA LSEQGDTLTQ       840
     AADTARREES EAEAALRTAE QRAAQAGEAL ATAREARATA AARAEAADEK RVETNRLSGE       900
     RFECPPPVLP EKLGFASADI RIAQSEQAEH DRLVTERERI GPVNLVAAQE LEELEATQAN       960
     SRAESEELSQ AINRLRGSIG SLNREGRQRL LAAFEAVDGH FRRLFTTLFN GGQAHLELID      1020
     SDDPLEAGLE IMAQPPGKKL AALTLLSGGE QALTAVALIF GLFLTNPAPI CVLDEVDAPL      1080
     DDANVERFCD LLDAMVAQTD TRYLIVSHNA VTMARMHRLF GVTMVERGVS RLVSVNLGGA      1140
     EALLAAE                                                                1147
//

If you have problems or comments...

PBIL Back to PBIL home page