(data stored in ACNUC7421 zone)

EMBL: AP010803.SSB

AP010803.SSB         Location/Qualifiers
FT   CDS             315507..316064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SJA_C1-02990"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95133"
FT                   /db_xref="GOA:D4YXQ1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ1"
FT                   /protein_id="BAI95133.1"
FT                   /translation="MAGSVNKVILVGNLGADPEVKSFQNGGKVCNLRIATSESWKDRMS
FT                   GERKERTEWHSVAIFSEGLAGVAERFLRKGSKVYLEGQLRTRKWQDQSGNDRYTTEVVL
FT                   QGPGAVLTMLDGAPGGGGQGGGGRSQGGGDWSGGSSGFGGGDYDDFGGGGFGGGSGRSS
FT                   GGGRGSAGGPNFDNDLDDEVPF"
     MAGSVNKVIL VGNLGADPEV KSFQNGGKVC NLRIATSESW KDRMSGERKE RTEWHSVAIF        60
     SEGLAGVAER FLRKGSKVYL EGQLRTRKWQ DQSGNDRYTT EVVLQGPGAV LTMLDGAPGG       120
     GGQGGGGRSQ GGGDWSGGSS GFGGGDYDDF GGGGFGGGSG RSSGGGRGSA GGPNFDNDLD       180
     DEVPF                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page