(data stored in SCRATCH zone)

EMBL: AP010803.STBE

AP010803.STBE        Location/Qualifiers
FT   CDS             complement(508098..508379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbE"
FT                   /gene_synonym="relE"
FT                   /locus_tag="SJA_C1-05010"
FT                   /product="StbE/RelE-family protein"
FT                   /note="plasmid stabilization system / addiction module
FT                   toxin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95335"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA3"
FT                   /protein_id="BAI95335.1"
FT                   /translation="MRTIERFGRFKRDYKREKKGQHAKTLDADLIPIIEALASDEPLEP
FT                   RHRDHALTGDWRDHRDCHIKPDLVLIYRKPDDDTLQLVRLGSHAELGW"
     MRTIERFGRF KRDYKREKKG QHAKTLDADL IPIIEALASD EPLEPRHRDH ALTGDWRDHR        60
     DCHIKPDLVL IYRKPDDDTL QLVRLGSHAE LGW                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page