(data stored in ACNUC7421 zone)

EMBL: AP010803.TERC

AP010803.TERC        Location/Qualifiers
FT   CDS             complement(34791..35510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terC"
FT                   /locus_tag="SJA_C1-00350"
FT                   /product="tellurite resistance protein TerC"
FT                   /note="membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94869"
FT                   /db_xref="GOA:D4YWY7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY7"
FT                   /protein_id="BAI94869.1"
FT                   /translation="MIDLIATAAAAAQGIGSPADIWAHIVNDFSNIGSPAALAAFGQVL
FT                   MIDVLLAGDNAIVVGALAAGLPAEQRKRVILIGIIAALVLRIGFALVVTQLMQIVGLIL
FT                   AGGLLLLWVAFKMWRELHPKRGGDTPDTGDDDISGLRPAKSFAGAAWAVAVADVSMSLD
FT                   NVLAVAGAARDHPGILIIGLILSVALMGIAANIIAKYIERFRWIAYLGLAVIVYVAVKM
FT                   IYDGVVDHQVGILTLFV"
     MIDLIATAAA AAQGIGSPAD IWAHIVNDFS NIGSPAALAA FGQVLMIDVL LAGDNAIVVG        60
     ALAAGLPAEQ RKRVILIGII AALVLRIGFA LVVTQLMQIV GLILAGGLLL LWVAFKMWRE       120
     LHPKRGGDTP DTGDDDISGL RPAKSFAGAA WAVAVADVSM SLDNVLAVAG AARDHPGILI       180
     IGLILSVALM GIAANIIAKY IERFRWIAYL GLAVIVYVAV KMIYDGVVDH QVGILTLFV        239
//

If you have problems or comments...

PBIL Back to PBIL home page