(data stored in ACNUC7421 zone)

EMBL: AP010803.THIL

AP010803.THIL        Location/Qualifiers
FT   CDS             complement(293833..294747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SJA_C1-02770"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95111"
FT                   /db_xref="GOA:D4YXM9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM9"
FT                   /protein_id="BAI95111.1"
FT                   /translation="MSAESRFLTLLRLLANDPAAQGLRDDVAVLEVGGARLILTSDTMV
FT                   EGVHHLPADPPADIGWKLAAVNLSDLAAKGAKPLGCLLNYALSGDESWDAAFLEGLGEA
FT                   LARHAMPLLGGDTVQMPRGAPRSYSLTALGEATGPVPLRGGAKAGDRLYLTGPVGDAGI
FT                   GLELLQTMPRASGPLVDAYRRPRPRLAEGALLAPHVHAMMDVSDGLLIDAARMAEASGL
FT                   AVTIDHIPLSPALEATRGASNAVQIAAARAGDDYELLFALPAAVKPPVRAIPVGRFAKG
FT                   GGLTLKIDGVAIPLPDRLGWEHG"
     MSAESRFLTL LRLLANDPAA QGLRDDVAVL EVGGARLILT SDTMVEGVHH LPADPPADIG        60
     WKLAAVNLSD LAAKGAKPLG CLLNYALSGD ESWDAAFLEG LGEALARHAM PLLGGDTVQM       120
     PRGAPRSYSL TALGEATGPV PLRGGAKAGD RLYLTGPVGD AGIGLELLQT MPRASGPLVD       180
     AYRRPRPRLA EGALLAPHVH AMMDVSDGLL IDAARMAEAS GLAVTIDHIP LSPALEATRG       240
     ASNAVQIAAA RAGDDYELLF ALPAAVKPPV RAIPVGRFAK GGGLTLKIDG VAIPLPDRLG       300
     WEHG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page