(data stored in ACNUC7421 zone)

EMBL: AP010803.TONB

AP010803.TONB        Location/Qualifiers
FT   CDS             306570..307259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SJA_C1-02890"
FT                   /product="TonB-like protein"
FT                   /note="periplasmic protein TonB, links inner and outer
FT                   membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95123"
FT                   /db_xref="GOA:D4YXP1"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP1"
FT                   /protein_id="BAI95123.1"
FT                   /translation="MQWISTGAAGGETISGYSGGRRSPIGIGGAVAVHALVFGAYLLMP
FT                   KEVIDTFRSSPFTTYAVPETPPPPPEEAAPETDSKIPPKARSQPTTVSDPIVDTVIKGG
FT                   FTAKADDHPTGDSGTGTITPPIIPPLPEPVLAEASIDPRALAAFQPDYPGAMIRQGMEG
FT                   KVVVRVTIGPDGRVIDIERLSAADEAFWIATQRHALRKWRFRPATRDGVPVSSTKVLTV
FT                   HFRLADV"
     MQWISTGAAG GETISGYSGG RRSPIGIGGA VAVHALVFGA YLLMPKEVID TFRSSPFTTY        60
     AVPETPPPPP EEAAPETDSK IPPKARSQPT TVSDPIVDTV IKGGFTAKAD DHPTGDSGTG       120
     TITPPIIPPL PEPVLAEASI DPRALAAFQP DYPGAMIRQG MEGKVVVRVT IGPDGRVIDI       180
     ERLSAADEAF WIATQRHALR KWRFRPATRD GVPVSSTKVL TVHFRLADV                   229
//

If you have problems or comments...

PBIL Back to PBIL home page