(data stored in ACNUC7421 zone)

EMBL: AP010803.TRAO

AP010803.TRAO        Location/Qualifiers
FT   CDS             complement(464859..465728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traO"
FT                   /locus_tag="SJA_C1-04560"
FT                   /product="DNA transfer TraO-like protein"
FT                   /note="putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95290"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY58"
FT                   /protein_id="BAI95290.1"
FT                   /translation="MSAEKPESSRGARKRSNAISIGEASPSGRSEKHGPDAPEPLGKKE
FT                   KGQRPPRSVSTGDMPETLQKRYFSSTSKWSGEPAYFTTAQAKEPAFRDQGRRLVTSSDS
FT                   EEVVRDLVAIARHRGWTNVHLTGSEAFRRAAWLEANRQGLDVRGYRPNERDLQELDRLK
FT                   LGNDRNSIAPAAVPSVTRESGRDQSQAHERSARSRAAASVGRNERAAQSQLRVIEAVVR
FT                   TALFDNPEAISRVMKVATTTLQNHVDRGDQIRPALLREGRDRKGLDVAPNRNESSRVHP
FT                   PVQRSRSR"
     MSAEKPESSR GARKRSNAIS IGEASPSGRS EKHGPDAPEP LGKKEKGQRP PRSVSTGDMP        60
     ETLQKRYFSS TSKWSGEPAY FTTAQAKEPA FRDQGRRLVT SSDSEEVVRD LVAIARHRGW       120
     TNVHLTGSEA FRRAAWLEAN RQGLDVRGYR PNERDLQELD RLKLGNDRNS IAPAAVPSVT       180
     RESGRDQSQA HERSARSRAA ASVGRNERAA QSQLRVIEAV VRTALFDNPE AISRVMKVAT       240
     TTLQNHVDRG DQIRPALLRE GRDRKGLDVA PNRNESSRVH PPVQRSRSR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page