(data stored in ACNUC7421 zone)

EMBL: AP010803.UHPA

AP010803.UHPA        Location/Qualifiers
FT   CDS             499821..500444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uhpA"
FT                   /locus_tag="SJA_C1-04940"
FT                   /product="response regulator UhpA"
FT                   /note="two-component system, NarL family, uhpT operon
FT                   response regulator UhpA / response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95328"
FT                   /db_xref="GOA:D4YY96"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY96"
FT                   /protein_id="BAI95328.1"
FT                   /translation="MGDRRVIHLVDDEESIRKAASFALKTAGYDVVTYASGVEFLKEAK
FT                   SAAVGCVILDVRMPEMDGLEVQAAMAARGVNMPVIVLTGHGDVSVAVQAMKGGAVDFLE
FT                   KPFEKAALLGAVSRAFARLDDVDLRTLETSEAGVRVAALTPREREVLERLANGLPNKTI
FT                   AYDLGCSSRTVEVHRASLMAKLEVRNLSEALRIAFAAGMGRKPK"
     MGDRRVIHLV DDEESIRKAA SFALKTAGYD VVTYASGVEF LKEAKSAAVG CVILDVRMPE        60
     MDGLEVQAAM AARGVNMPVI VLTGHGDVSV AVQAMKGGAV DFLEKPFEKA ALLGAVSRAF       120
     ARLDDVDLRT LETSEAGVRV AALTPREREV LERLANGLPN KTIAYDLGCS SRTVEVHRAS       180
     LMAKLEVRNL SEALRIAFAA GMGRKPK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page