(data stored in ACNUC7421 zone)

EMBL: AP010803.VIRB1

AP010803.VIRB1       Location/Qualifiers
FT   CDS             complement(476781..477446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="SJA_C1-04680"
FT                   /product="type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95302"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY70"
FT                   /protein_id="BAI95302.1"
FT                   /translation="MILDVATLLSLAGACAPTVAPETLISIVHTESRFNSLAIGVNSPG
FT                   VRAPKPATKAQAIAAARSLIGRGYNIDLGLGQINSANLGWLGLSVENAFEPCSNLAAAA
FT                   RVLATNYQAVARLAPSRDHAIATALSLYNTGDRQRGFRNGYVARVYASASAVIPLIRST
FT                   APATRNSVVAPAAPAFAPPPDTPVSPPAAAGWNTAARASQASLMVFGDGAASQKGQHP"
     MILDVATLLS LAGACAPTVA PETLISIVHT ESRFNSLAIG VNSPGVRAPK PATKAQAIAA        60
     ARSLIGRGYN IDLGLGQINS ANLGWLGLSV ENAFEPCSNL AAAARVLATN YQAVARLAPS       120
     RDHAIATALS LYNTGDRQRG FRNGYVARVY ASASAVIPLI RSTAPATRNS VVAPAAPAFA       180
     PPPDTPVSPP AAAGWNTAAR ASQASLMVFG DGAASQKGQH P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page