(data stored in ACNUC7421 zone)

EMBL: AP010803.YAJC

AP010803.YAJC        Location/Qualifiers
FT   CDS             597581..597916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SJA_C1-05870"
FT                   /product="preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95421"
FT                   /db_xref="GOA:D4YYI9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI9"
FT                   /protein_id="BAI95421.1"
FT                   /translation="MFISPAFAQTAGGESSGASMLVQMAPLVLIFVVFYFLLIRPQQKK
FT                   MKEHKAKIDAVKKGDQVVTGGGLVGKVVRVDEFYADVELAPGMKVKAVKSTLTDVIDPA
FT                   TAKPAND"
     MFISPAFAQT AGGESSGASM LVQMAPLVLI FVVFYFLLIR PQQKKMKEHK AKIDAVKKGD        60
     QVVTGGGLVG KVVRVDEFYA DVELAPGMKV KAVKSTLTDV IDPATAKPAN D                111
//

If you have problems or comments...

PBIL Back to PBIL home page