(data stored in ACNUC7421 zone)

EMBL: AP010803.YAPH

AP010803.YAPH        Location/Qualifiers
FT   CDS             complement(121742..125464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yapH"
FT                   /locus_tag="SJA_C1-01250"
FT                   /product="putative autotransporter YapH"
FT                   /note="uncharacterized protein with a C-terminal OMP (outer
FT                   membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94959"
FT                   /db_xref="GOA:D4YX77"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX77"
FT                   /protein_id="BAI94959.1"
FT                   /translation="MRGEGRRGAIAQSVSKVGRLASDSIAALVVGGLMVLPDSAEAQPA
FT                   LRFWDGGDPAERENGVIDGGSGVWSATDPNWTDSSGTVNGPMRPVPAFTVFQGQAGTIT
FT                   IDDSNGIPAVTGMHFLTDGYRLVGGQLKLDGGAYSSIRSTAGATTRIDAQLTGNGGVFF
FT                   NDLGTVILTGANSYQGNSRVDGGTVIGNTDSIRGNLENGGTVIFDQNRDGIFAGGVSGL
FT                   FSFWGFMIKRGEGALTLGGSNNLDWRVEEGALVARAAGFGGNVEIGAAGRLTFDAGEGT
FT                   GAETIYPYALSGDGRFDVKGANMLVLTGQSTFSGRTEVADSALRVDGALGGMLHVGANG
FT                   MLSGGGQVGAVEIATGGRLTGRAGATLHMGSLALGDGSITEASFGTTQDPALFDVAGDL
FT                   TLDGTLHVANGAPLGEGLYRLISYGGQLTDRGLEIGALPPGQAADSLSIQTATVGQVNL
FT                   LSGTAARPLQFWDGGDPTRYGNGRVDGGPGVWRNGALSWTGQDGTVNEAGKANGFAIFT
FT                   GNSGQVLIDNSAGAVKTGGLQFATGGYVLSGGTLTLAGGDRTVIRVGAGSVWDSSLTAE
FT                   IAAPLSGTTTLVKRDAGTLILSGANSYTGDTEVEAGTLVGNARALRGNVRNAATLVFDQ
FT                   RENGSFSGSIRALDGNAGTMVKRGSGVLTLTGPSTLDWRLEEGRLATAASRFTGNADLR
FT                   PGAELQFAETISSRYSGRIGGSGRFIKAGGGALTLDGDSSGFTGSTQLQSGRLIVDGKL
FT                   GGQIAVEANALLSGRGTLGSVRVAPGGRIAPGPGIAKLHVEGDLTFAPGSRYEVEVDPF
FT                   GTSADAIIVTGVATLGGTVAHIGANGNYRPRSTYVILLAEGGVQGRFDAVTSTYAFLTP
FT                   TLRYGHDSVRLRLDRNDVRFSDVAASSNQQATGAALERMAAGSKVQDAVLMSDAETARK
FT                   AFDQLSGEFHASLRAALIQNSSLSRDAALDRLRATIPDRPGLTYWGQALDAWSHWRSDG
FT                   NAARFDQSSSGGLMGIEAQAPDGSFRLGMIGGHNRDRMRGQGQADVDSYHAGLYGGGTL
FT                   GRVALRGGLAFAWQDIAVQRSVRFSGFAEGVATQYRATTAQMFGETAYRIETAAGSIEP
FT                   FASIAHVRLDVGRGQESGAAAALQLEADSLRTSYATAGTRGDLDLAVGGARLAVRASAG
FT                   WQHVFGDQLPVVQAGLDGQRFAVSGLPIARDSLISELRLHGAIRDRLQINLGYRGAIAR
FT                   SGQNHQLQAGLNWQF"
     MRGEGRRGAI AQSVSKVGRL ASDSIAALVV GGLMVLPDSA EAQPALRFWD GGDPAERENG        60
     VIDGGSGVWS ATDPNWTDSS GTVNGPMRPV PAFTVFQGQA GTITIDDSNG IPAVTGMHFL       120
     TDGYRLVGGQ LKLDGGAYSS IRSTAGATTR IDAQLTGNGG VFFNDLGTVI LTGANSYQGN       180
     SRVDGGTVIG NTDSIRGNLE NGGTVIFDQN RDGIFAGGVS GLFSFWGFMI KRGEGALTLG       240
     GSNNLDWRVE EGALVARAAG FGGNVEIGAA GRLTFDAGEG TGAETIYPYA LSGDGRFDVK       300
     GANMLVLTGQ STFSGRTEVA DSALRVDGAL GGMLHVGANG MLSGGGQVGA VEIATGGRLT       360
     GRAGATLHMG SLALGDGSIT EASFGTTQDP ALFDVAGDLT LDGTLHVANG APLGEGLYRL       420
     ISYGGQLTDR GLEIGALPPG QAADSLSIQT ATVGQVNLLS GTAARPLQFW DGGDPTRYGN       480
     GRVDGGPGVW RNGALSWTGQ DGTVNEAGKA NGFAIFTGNS GQVLIDNSAG AVKTGGLQFA       540
     TGGYVLSGGT LTLAGGDRTV IRVGAGSVWD SSLTAEIAAP LSGTTTLVKR DAGTLILSGA       600
     NSYTGDTEVE AGTLVGNARA LRGNVRNAAT LVFDQRENGS FSGSIRALDG NAGTMVKRGS       660
     GVLTLTGPST LDWRLEEGRL ATAASRFTGN ADLRPGAELQ FAETISSRYS GRIGGSGRFI       720
     KAGGGALTLD GDSSGFTGST QLQSGRLIVD GKLGGQIAVE ANALLSGRGT LGSVRVAPGG       780
     RIAPGPGIAK LHVEGDLTFA PGSRYEVEVD PFGTSADAII VTGVATLGGT VAHIGANGNY       840
     RPRSTYVILL AEGGVQGRFD AVTSTYAFLT PTLRYGHDSV RLRLDRNDVR FSDVAASSNQ       900
     QATGAALERM AAGSKVQDAV LMSDAETARK AFDQLSGEFH ASLRAALIQN SSLSRDAALD       960
     RLRATIPDRP GLTYWGQALD AWSHWRSDGN AARFDQSSSG GLMGIEAQAP DGSFRLGMIG      1020
     GHNRDRMRGQ GQADVDSYHA GLYGGGTLGR VALRGGLAFA WQDIAVQRSV RFSGFAEGVA      1080
     TQYRATTAQM FGETAYRIET AAGSIEPFAS IAHVRLDVGR GQESGAAAAL QLEADSLRTS      1140
     YATAGTRGDL DLAVGGARLA VRASAGWQHV FGDQLPVVQA GLDGQRFAVS GLPIARDSLI      1200
     SELRLHGAIR DRLQINLGYR GAIARSGQNH QLQAGLNWQF                            1240
//

If you have problems or comments...

PBIL Back to PBIL home page