(data stored in ACNUC7421 zone)

EMBL: AP010803.YBEA

AP010803.YBEA        Location/Qualifiers
FT   CDS             complement(271296..271718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="SJA_C1-02550"
FT                   /product="conserved hypothetical protein YbeA"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95089"
FT                   /db_xref="GOA:D4YXK7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK7"
FT                   /protein_id="BAI95089.1"
FT                   /translation="MLLHIIARGKIGRSPEAELVDRYARRLTMPFRITELPDRGGKLPP
FT                   APPGTVTVMLDEKGRQLSSIDFARRIEGWRDSGKRECRFLIGAADGFDDAERDNADLLI
FT                   AFGAMTWPHMMARAMLAEQLWRACSILAGHPYHREG"
     MLLHIIARGK IGRSPEAELV DRYARRLTMP FRITELPDRG GKLPPAPPGT VTVMLDEKGR        60
     QLSSIDFARR IEGWRDSGKR ECRFLIGAAD GFDDAERDNA DLLIAFGAMT WPHMMARAML       120
     AEQLWRACSI LAGHPYHREG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page