(data stored in ACNUC7421 zone)

EMBL: AP010803.YKVM

AP010803.YKVM        Location/Qualifiers
FT   CDS             692581..693054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykvM"
FT                   /gene_synonym="queF"
FT                   /locus_tag="SJA_C1-06920"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="enzyme related to GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95526"
FT                   /db_xref="GOA:D4YYU4"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU4"
FT                   /protein_id="BAI95526.1"
FT                   /translation="MTDMPTPLQPSPIHLGQTSALPARPEDAVLDYVPNPRPGKPYLVR
FT                   FTAPEFTSLCPVTGQPDFAHLVIDYAPAATIVESKSLKLFLGAFRNHAAFHEDCTVGIG
FT                   ERLFAEMNPIWLRIGGYWYPRGGIPIDVFWQSGEPPAGLWLPPQDVPGYRGRG"
     MTDMPTPLQP SPIHLGQTSA LPARPEDAVL DYVPNPRPGK PYLVRFTAPE FTSLCPVTGQ        60
     PDFAHLVIDY APAATIVESK SLKLFLGAFR NHAAFHEDCT VGIGERLFAE MNPIWLRIGG       120
     YWYPRGGIPI DVFWQSGEPP AGLWLPPQDV PGYRGRG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page