(data stored in ACNUC30630 zone)

EMBL: AP010890.PE119

AP010890.PE119       Location/Qualifiers
FT   CDS             154454..155179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70266"
FT                   /db_xref="GOA:E8MWW3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW3"
FT                   /protein_id="BAJ70266.1"
FT                   /translation="MGFVNFIIELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGVFAAPDAATGKAALPLFWLLPVVWCAPIIGDQCNYFIGHFFGRRI
FT                   IQSGKVKALTPERLAKTEGMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPF
FT                   SVLGGLCWSTLFTLLGYFFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPA
FT                   KVTDAQLDVMEDGIKNLDK"
     MGFVNFIIEL LKDPRAAIAG WIAMGVAPTL GFIFLIVFIE TGVVFFPFLP GDSLLFAAGV        60
     FAAPDAATGK AALPLFWLLP VVWCAPIIGD QCNYFIGHFF GRRIIQSGKV KALTPERLAK       120
     TEGMIEKWGP LAVFLGRFFP FIRTFMPFIS GISGMRWSRF TPFSVLGGLC WSTLFTLLGY       180
     FFGNIPAVQD HFELVIVLIL LVSLAPTIIG LLKAKFGKKK PAKVTDAQLD VMEDGIKNLD       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page