(data stored in ACNUC30630 zone)

EMBL: AP010890.PE125

AP010890.PE125       Location/Qualifiers
FT   CDS             159259..159636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70272"
FT                   /db_xref="GOA:E8MWW9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW9"
FT                   /protein_id="BAJ70272.1"
FT                   /translation="MKTMTCRWRLARLPPDLCTGSATAEFAIVLPSVIAIAGLILAIGR
FT                   VVIVSMDCQSAAAAAAREFVVTGDESSSRSIAADVAGGEPRVIIAHDGQSTSVMVECSV
FT                   LPGPLDVTPTRVTGNATAISQ"
     MKTMTCRWRL ARLPPDLCTG SATAEFAIVL PSVIAIAGLI LAIGRVVIVS MDCQSAAAAA        60
     AREFVVTGDE SSSRSIAADV AGGEPRVIIA HDGQSTSVMV ECSVLPGPLD VTPTRVTGNA       120
     TAISQ                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page