(data stored in ACNUC30630 zone)

EMBL: AP010890.PE13

AP010890.PE13        Location/Qualifiers
FT   CDS             complement(17754..18746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70160"
FT                   /db_xref="GOA:E8MWK7"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK7"
FT                   /protein_id="BAJ70160.1"
FT                   /translation="MLFQVYGDNAIYQWIGWILVFCCLIGANELARRTKTGGVIAFLVI
FT                   PAVLTVYFITIYTAAAMGADWALNNPTYVHMTSWFHYAKLYAATIGCIGFMALKYKWGS
FT                   IGKSHWFKCFPFVIVAINILIAVVSDFESAIRGWGTTWISTEGVTLYGGWHNVFNGVAG
FT                   LLNIFCMTGWFGIYASKKKDDMLWPDMTWVFIVAYDLWNFCYTYNCLPTHAWYCGLALL
FT                   LAPTVANFFWNKGGWIQNRANTLAIWCMFAQVFPMFQDYSMFSTQSVNNPNVNLAVSLI
FT                   ALAANVLALGYILLRAKKQGINPWTKEVFKGTKDYEQAIARADESELAA"
     MLFQVYGDNA IYQWIGWILV FCCLIGANEL ARRTKTGGVI AFLVIPAVLT VYFITIYTAA        60
     AMGADWALNN PTYVHMTSWF HYAKLYAATI GCIGFMALKY KWGSIGKSHW FKCFPFVIVA       120
     INILIAVVSD FESAIRGWGT TWISTEGVTL YGGWHNVFNG VAGLLNIFCM TGWFGIYASK       180
     KKDDMLWPDM TWVFIVAYDL WNFCYTYNCL PTHAWYCGLA LLLAPTVANF FWNKGGWIQN       240
     RANTLAIWCM FAQVFPMFQD YSMFSTQSVN NPNVNLAVSL IALAANVLAL GYILLRAKKQ       300
     GINPWTKEVF KGTKDYEQAI ARADESELAA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page