(data stored in ACNUC30630 zone)

EMBL: AP010890.PE133

AP010890.PE133       Location/Qualifiers
FT   CDS             169440..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0133"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70280"
FT                   /db_xref="GOA:E8MWX7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX7"
FT                   /protein_id="BAJ70280.1"
FT                   /translation="MALIVQKYGGSSVADTESIKRVAKRVVETEKKGNKVAVVVSAMGD
FT                   TTDDLIDQALSIDSNPPEREMDMLMTAGERISMSLLAMAIHAEGSRAHSFTGQQAGFFT
FT                   DARYGAAHIKAVRPDRVKNALSLGDIAIVAGFQGINAKGDATTLGRGGSDTSAVALAVA
FT                   LGADICEIYTDVDGIFTADPRIVPSARRIPSIDYESILEMASCGSKVLALRCVEYAQRF
FT                   NMPLHVRSSFSRRPGTLVVPDGIDPRTLPNLD"
     MALIVQKYGG SSVADTESIK RVAKRVVETE KKGNKVAVVV SAMGDTTDDL IDQALSIDSN        60
     PPEREMDMLM TAGERISMSL LAMAIHAEGS RAHSFTGQQA GFFTDARYGA AHIKAVRPDR       120
     VKNALSLGDI AIVAGFQGIN AKGDATTLGR GGSDTSAVAL AVALGADICE IYTDVDGIFT       180
     ADPRIVPSAR RIPSIDYESI LEMASCGSKV LALRCVEYAQ RFNMPLHVRS SFSRRPGTLV       240
     VPDGIDPRTL PNLD                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page