(data stored in ACNUC30630 zone)

EMBL: AP010890.PE134

AP010890.PE134       Location/Qualifiers
FT   CDS             170260..170826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0134"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70281"
FT                   /db_xref="GOA:E8MWX8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX8"
FT                   /protein_id="BAJ70281.1"
FT                   /translation="MTEEEAKSMGDLFPDLGPEAPVISGIAHDRSEALATVRGVPNEPG
FT                   MAAKVFTELATAGVNVDMIVQAGASVGTADISFTVPESAVKQVQNTLLDKQEVLGYHSF
FT                   DVDTNVGKVAVVGVGMKTHAGLAAKFFQALSDEGINVLMISTSEIRIAALVPLDQLNDA
FT                   VKALHTAYGLDADQIEAVVYGGTGR"
     MTEEEAKSMG DLFPDLGPEA PVISGIAHDR SEALATVRGV PNEPGMAAKV FTELATAGVN        60
     VDMIVQAGAS VGTADISFTV PESAVKQVQN TLLDKQEVLG YHSFDVDTNV GKVAVVGVGM       120
     KTHAGLAAKF FQALSDEGIN VLMISTSEIR IAALVPLDQL NDAVKALHTA YGLDADQIEA       180
     VVYGGTGR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page