(data stored in ACNUC30630 zone)

EMBL: AP010890.PE150

AP010890.PE150       Location/Qualifiers
FT   CDS             193555..194214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70297"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ4"
FT                   /protein_id="BAJ70297.1"
FT                   /translation="MSATTIHFVRHGKVYNPDHLLYERLPDFHLSDLGRRMAQATATYL
FT                   AKNPQTNTIAAVYSSPLDRTRETAGAILDALNPVREARGEAPLTLTTDERVIEAGNEFR
FT                   GKRIGHGEGALWKNGNWKLVTNLYKPSWGESYQHIAARMDDFAREKVAQHPGEQIVVVS
FT                   HESPIFSYRHYLETGHPEHWMFLRHTALASVTSVTYDNETGRVMSITYVDPAANVK"
     MSATTIHFVR HGKVYNPDHL LYERLPDFHL SDLGRRMAQA TATYLAKNPQ TNTIAAVYSS        60
     PLDRTRETAG AILDALNPVR EARGEAPLTL TTDERVIEAG NEFRGKRIGH GEGALWKNGN       120
     WKLVTNLYKP SWGESYQHIA ARMDDFAREK VAQHPGEQIV VVSHESPIFS YRHYLETGHP       180
     EHWMFLRHTA LASVTSVTYD NETGRVMSIT YVDPAANVK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page